PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011694P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 648aa    MW: 72643 Da    PI: 6.233
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011694P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.42.3e-2966150187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+++r+em+ ++r+++ k+plWe++s+k+ e g++rs+k+Ckek+en+ k++k++ke +++  +++s+t+++f+qlea
  MELO3C011694P1  66 RWPRQETLALLKIRSEMDVAFRDASVKGPLWEQISRKLGELGYHRSAKKCKEKFENVYKYHKRTKEVRSG--KPDSKTYKFFEQLEA 150
                     8********************************************************************9..58999********85 PP

2trihelix101.56.5e-32467552187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev+aLi++r+++e++++++  k+plWee+s++m++ g++r++k+Ckekwen+nk++kk+ke++k r +e+s+tcpyf+ql+a
  MELO3C011694P1 467 RWPKVEVQALIKLRTNLETKYQENGPKGPLWEEISSAMKKLGYNRNAKRCKEKWENINKYFKKVKESRKTR-PEDSKTCPYFHQLDA 552
                     8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.6E-563125IPR001005SANT/Myb domain
PROSITE profilePS500907.1265123IPR017877Myb-like domain
CDDcd122032.39E-2365130No hitNo description
PfamPF138375.2E-1965151No hitNo description
Gene3DG3DSA:1.10.10.606.4E-5460523IPR009057Homeodomain-like
PROSITE profilePS500907.573460524IPR017877Myb-like domain
SMARTSM007170.0015464526IPR001005SANT/Myb domain
PfamPF138375.7E-22466553No hitNo description
CDDcd122031.37E-26467531No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MLGDSITSVL GGGAGGDAAV PATTTRRQDG LMGDMDENNN NSGEDERGRS SGGGGDDGDR  60
SFGGNRWPRQ ETLALLKIRS EMDVAFRDAS VKGPLWEQIS RKLGELGYHR SAKKCKEKFE  120
NVYKYHKRTK EVRSGKPDSK TYKFFEQLEA LENHPPLNFH SHLSKPTPPP PLPPPPTTVI  180
SHIPSTTVPS ATTTTLPHLL NISFSQPNPT IHLPSPPPPP APLPLNNPTS FPTTVPPAVP  240
FQINVSSTGM GMGFQSIEAD LISNSTSDDV NSSTSSDEAS RRRRRKRKWK DFFERLMKEV  300
IEKQEEMQKR FLEAIEKREQ ERVLREEAWR MQEMAKINRE REILAQERSM AAAKDAAITS  360
FLQKITESQH NNNNNTSQPS PPPPPPAPPS QQQQIPTSNP TPVVHPQQQL QPPPPPAPQA  420
STLQVVVPNS TPQKVGSNNE LLQMEIMKMD HNGGENYSIS PASSSSRWPK VEVQALIKLR  480
TNLETKYQEN GPKGPLWEEI SSAMKKLGYN RNAKRCKEKW ENINKYFKKV KESRKTRPED  540
SKTCPYFHQL DALYREKSNN NNNNMMASST PIMQHQQQPL MVRPEQQWPP QQEITRPDSG  600
NEEMESEPMD RDDKDDDEED EEEEEEDEGG GNYEIVASKP ASVTAAE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281287RRRRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818170.0LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445774.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0A0KCE10.0A0A0A0KCE1_CUCSA; Uncharacterized protein
STRINGGLYMA02G09060.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-56Trihelix family protein